insulinoma antigen 2 (ia-2)853–872 peptide (Proimmune)
90
Structured Review
Proimmune
insulinoma antigen 2 (ia-2)853–872 peptide
Insulinoma Antigen 2 (Ia 2)853–872 Peptide, supplied by Proimmune, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ia-2-peptide/insulinoma+antigen+2++ia+2+853+872+peptide/pm28131926-92-25-30
Average 90 stars, based on 1 article reviews
Insulinoma Antigen 2 (Ia 2)853–872 Peptide, supplied by Proimmune, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/ia-2-peptide/insulinoma+antigen+2++ia+2+853+872+peptide/pm28131926-92-25-30
Average 90 stars, based on 1 article reviews
insulinoma antigen 2 (ia-2)853–872 peptide - by Bioz Stars,
2026-10
90/100 stars
Images
Related Articles
In Vitro:Article Title: General immune dampening is associated with disturbed metabolism at diagnosis of type 1 diabetes. Article Snippet: In Vitro Cell Culturing Aliquots of one million PBMCs (~91% viability for each population) were diluted in 1,000 μl AIM V research-grade serum-free medium (Gibco; Invitrogen, Stockholm, Sweden) supplemented with 2 mmol/l l-glutamine, 50 μg/l streptomycin sulfate, 10 μg/l gentamicin sulfate, and 2 × 10−5 mol/l 2-mercaptoethanol (Sigma, Stockholm, Sweden) and incubated in medium alone (spontaneous secretion) or stimulated with 5 μg/ml of the autoantigens GAD65 (protein; Diamyd Diagnostics AB, Stockholm, Sweden), the synthetic peptide of GAD65 AA 247–279 (NMYAMMIARFKMFPEVKEKGMAALPRLIAFTSE-OH) with molecular weight 3823.7 (Department of Medical and Physiological Chemistry, University of Uppsala, Sweden), a peptide of heat-shock protein 60 AA 437–460 (DiaPep277, a gift from B. Roep, Leiden University Medical Center, Leiden, The Netherlands) and the mitogen PHA (Sigma), 0.5 μg/ml insulin peptide (AA 9–23, Sigma, Genosys, Canada), and 10 μg/ml Cell Culture:Article Title: General immune dampening is associated with disturbed metabolism at diagnosis of type 1 diabetes. Article Snippet: In Vitro Cell Culturing Aliquots of one million PBMCs (~91% viability for each population) were diluted in 1,000 μl AIM V research-grade serum-free medium (Gibco; Invitrogen, Stockholm, Sweden) supplemented with 2 mmol/l l-glutamine, 50 μg/l streptomycin sulfate, 10 μg/l gentamicin sulfate, and 2 × 10−5 mol/l 2-mercaptoethanol (Sigma, Stockholm, Sweden) and incubated in medium alone (spontaneous secretion) or stimulated with 5 μg/ml of the autoantigens GAD65 (protein; Diamyd Diagnostics AB, Stockholm, Sweden), the synthetic peptide of GAD65 AA 247–279 (NMYAMMIARFKMFPEVKEKGMAALPRLIAFTSE-OH) with molecular weight 3823.7 (Department of Medical and Physiological Chemistry, University of Uppsala, Sweden), a peptide of heat-shock protein 60 AA 437–460 (DiaPep277, a gift from B. Roep, Leiden University Medical Center, Leiden, The Netherlands) and the mitogen PHA (Sigma), 0.5 μg/ml insulin peptide (AA 9–23, Sigma, Genosys, Canada), and 10 μg/ml Incubation:Article Title: General immune dampening is associated with disturbed metabolism at diagnosis of type 1 diabetes. Article Snippet: In Vitro Cell Culturing Aliquots of one million PBMCs (~91% viability for each population) were diluted in 1,000 μl AIM V research-grade serum-free medium (Gibco; Invitrogen, Stockholm, Sweden) supplemented with 2 mmol/l l-glutamine, 50 μg/l streptomycin sulfate, 10 μg/l gentamicin sulfate, and 2 × 10−5 mol/l 2-mercaptoethanol (Sigma, Stockholm, Sweden) and incubated in medium alone (spontaneous secretion) or stimulated with 5 μg/ml of the autoantigens GAD65 (protein; Diamyd Diagnostics AB, Stockholm, Sweden), the synthetic peptide of GAD65 AA 247–279 (NMYAMMIARFKMFPEVKEKGMAALPRLIAFTSE-OH) with molecular weight 3823.7 (Department of Medical and Physiological Chemistry, University of Uppsala, Sweden), a peptide of heat-shock protein 60 AA 437–460 (DiaPep277, a gift from B. Roep, Leiden University Medical Center, Leiden, The Netherlands) and the mitogen PHA (Sigma), 0.5 μg/ml insulin peptide (AA 9–23, Sigma, Genosys, Canada), and 10 μg/ml Molecular Weight:Article Title: General immune dampening is associated with disturbed metabolism at diagnosis of type 1 diabetes. Article Snippet: In Vitro Cell Culturing Aliquots of one million PBMCs (~91% viability for each population) were diluted in 1,000 μl AIM V research-grade serum-free medium (Gibco; Invitrogen, Stockholm, Sweden) supplemented with 2 mmol/l l-glutamine, 50 μg/l streptomycin sulfate, 10 μg/l gentamicin sulfate, and 2 × 10−5 mol/l 2-mercaptoethanol (Sigma, Stockholm, Sweden) and incubated in medium alone (spontaneous secretion) or stimulated with 5 μg/ml of the autoantigens GAD65 (protein; Diamyd Diagnostics AB, Stockholm, Sweden), the synthetic peptide of GAD65 AA 247–279 (NMYAMMIARFKMFPEVKEKGMAALPRLIAFTSE-OH) with molecular weight 3823.7 (Department of Medical and Physiological Chemistry, University of Uppsala, Sweden), a peptide of heat-shock protein 60 AA 437–460 (DiaPep277, a gift from B. Roep, Leiden University Medical Center, Leiden, The Netherlands) and the mitogen PHA (Sigma), 0.5 μg/ml insulin peptide (AA 9–23, Sigma, Genosys, Canada), and 10 μg/ml Cell Counting:Article Title: General immune dampening is associated with disturbed metabolism at diagnosis of type 1 diabetes. Article Snippet: In Vitro Cell Culturing Aliquots of one million PBMCs (~91% viability for each population) were diluted in 1,000 μl AIM V research-grade serum-free medium (Gibco; Invitrogen, Stockholm, Sweden) supplemented with 2 mmol/l l-glutamine, 50 μg/l streptomycin sulfate, 10 μg/l gentamicin sulfate, and 2 × 10−5 mol/l 2-mercaptoethanol (Sigma, Stockholm, Sweden) and incubated in medium alone (spontaneous secretion) or stimulated with 5 μg/ml of the autoantigens GAD65 (protein; Diamyd Diagnostics AB, Stockholm, Sweden), the synthetic peptide of GAD65 AA 247–279 (NMYAMMIARFKMFPEVKEKGMAALPRLIAFTSE-OH) with molecular weight 3823.7 (Department of Medical and Physiological Chemistry, University of Uppsala, Sweden), a peptide of heat-shock protein 60 AA 437–460 (DiaPep277, a gift from B. Roep, Leiden University Medical Center, Leiden, The Netherlands) and the mitogen PHA (Sigma), 0.5 μg/ml insulin peptide (AA 9–23, Sigma, Genosys, Canada), and 10 μg/ml |