Review



sox11  (Atlas Antibodies)


Bioz Verified Symbol Atlas Antibodies is a verified supplier
Bioz Manufacturer Symbol Atlas Antibodies manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 93
      Buy from Supplier

    Structured Review

    Atlas Antibodies sox11
    The molecular structure of <t>SOX11.</t> The SOX11 protein is composed of 441 amino acids. SOX11 contains two functional domains, the N-terminal HMG domain and the conserved TAD. SOX11, sex-determining region Y-related high-mobility-group box transcription factor 11; HMG, high mobility group; TAD, C-terminal transactivation domain.
    Sox11, supplied by Atlas Antibodies, used in various techniques. Bioz Stars score: 93/100, based on 31 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/microarray+human+scleroderma+data+set/Anti-SOX11/pmc06547177-27-12-8
    Average 93 stars, based on 31 article reviews
    sox11 - by Bioz Stars, 2026-11
    93/100 stars

    Images

    1) Product Images from "SOX11: friend or foe in tumor prevention and carcinogenesis?"

    Article Title: SOX11: friend or foe in tumor prevention and carcinogenesis?

    Journal: Therapeutic Advances in Medical Oncology

    doi: 10.1177/1758835919853449

    The molecular structure of SOX11. The SOX11 protein is composed of 441 amino acids. SOX11 contains two functional domains, the N-terminal HMG domain and the conserved TAD. SOX11, sex-determining region Y-related high-mobility-group box transcription factor 11; HMG, high mobility group; TAD, C-terminal transactivation domain.
    Figure Legend Snippet: The molecular structure of SOX11. The SOX11 protein is composed of 441 amino acids. SOX11 contains two functional domains, the N-terminal HMG domain and the conserved TAD. SOX11, sex-determining region Y-related high-mobility-group box transcription factor 11; HMG, high mobility group; TAD, C-terminal transactivation domain.

    Techniques Used: Functional Assay

    Overview of SOX11 function reported in diverse types of cancer.
    Figure Legend Snippet: Overview of SOX11 function reported in diverse types of cancer.

    Techniques Used: Expressing, Over Expression, Biomarker Discovery, Migration, Methylation, DNA Methylation Assay

    Overall carcinogenic actions of SOX11 on the hallmarks of tumor biology. SOX11 exerts tumor-stimulative effects through increasing cell proliferation, repressing cell differentiation, inducing angiogenesis, and promoting metastasis. BCL6, B-cell lymphoma 6; BNIP3, B-cell lymphoma 2 (BCL2)/adenovirus E1B 19 kDa protein-interacting protein 3; CIC, cancer-initiating cell; PAX5, Paired box protein 5; PDGFA, platelet-derived growth factor A; SETMAR, SET domain and mariner transposase fusion gene; SOX11, Sex-determining region Y-related high-mobility-group box transcription factor 11; TANK, TRAF family member-associated NF-κB activator.
    Figure Legend Snippet: Overall carcinogenic actions of SOX11 on the hallmarks of tumor biology. SOX11 exerts tumor-stimulative effects through increasing cell proliferation, repressing cell differentiation, inducing angiogenesis, and promoting metastasis. BCL6, B-cell lymphoma 6; BNIP3, B-cell lymphoma 2 (BCL2)/adenovirus E1B 19 kDa protein-interacting protein 3; CIC, cancer-initiating cell; PAX5, Paired box protein 5; PDGFA, platelet-derived growth factor A; SETMAR, SET domain and mariner transposase fusion gene; SOX11, Sex-determining region Y-related high-mobility-group box transcription factor 11; TANK, TRAF family member-associated NF-κB activator.

    Techniques Used: Cell Differentiation, Derivative Assay

    Different prognostic significance of SOX11 in tumor cases.
    Figure Legend Snippet: Different prognostic significance of SOX11 in tumor cases.

    Techniques Used: Expressing, Microarray, Over Expression

    Related Articles

    Formalin-fixed Paraffin-Embedded:

    Article Title: CD5-negative Mantle Cell Lymphoma: Clinicopathologic features of an indolent variant that confers a survival advantage
    Article Snippet: .. Formalin-fixed paraffin-embedded tissue sections were stained for SOX11 (1:100; Atlas Antibodies, Stockholm, Sweden). ..

    Staining:

    Article Title: CD5-negative Mantle Cell Lymphoma: Clinicopathologic features of an indolent variant that confers a survival advantage
    Article Snippet: .. Formalin-fixed paraffin-embedded tissue sections were stained for SOX11 (1:100; Atlas Antibodies, Stockholm, Sweden). ..

    Sequencing:

    Article Title: SOX11 regulates SWI/SNF complex components as member of the adrenergic neuroblastoma core regulatory circuitry
    Article Snippet: .. Sequencing depth IMR-32 SOX11 ChIP: Total mapped reads:75269021, Uniqually mapped reads: 58444500, Read length: 75 bp, single-end IMR-32 INPUT ChIP: Total mapped reads: 46283806, Uniqually mapped reads: 38101144, Read length: 75 bp, single-end IMR-32 SOX11 CUT&RUN: Total mapped reads: 9055406, Uniqually mapped reads: 6399393, Read length: 75 bp, pair-end IMR-32 IgG CUT&RUN: Total mapped reads: 8941165, Uniqually mapped reads: 5925768 Read length: 75 bp, pair-end CLB-GA SOX11 CUT&RUN: Total mapped reads: 9071586, Uniqually mapped reads: 6736893 Read length: 75 bp, pair-end CLB-GA IgG CUT&RUN: Total mapped reads: 8633535, Uniqually mapped reads: 594113, Read length: 75 bp, pair-end NGP SOX11 CUT&RUN: Total mapped reads: 9121804, Uniqually mapped reads: 6603935, Read length: 75 bp, pair-end NGP IgG CUT&RUN: Total mapped reads: 9118638, Uniqually mapped reads: 5897926, Read length: 75 bp, pair-end SH-EP SOX11 OE SOX11 CUT&RUN: Total mapped reads: 8509115, Uniqually mapped reads: 5373607, Read length: 75 bp, pair-end SH-EP SOX11 OE IgG CUT&RUN: Total mapped reads: 8247565, Uniqually mapped reads: 5869023, Read length: 75 bp, pair-end Antibodies CUT&RUN: anti-SOX11 antibody (HPA000536, Atlas Antibodies) and anti-IgG goat antibody (sc-2028, Santa Cruz Biotechnology) was used. .. ChIP: The rabbit polyclonal antibody, SOX11-PAb, was custom made (Absea biotechnology, China) against the immunogenic peptide p-SOX11C-term DDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPP PLAQPALSPASSRSVSTSSS Peak calling parameters Read mapping was done with bowtie2 and index hg19.

    Chromatin Immunoprecipitation:

    Article Title: SOX11 regulates SWI/SNF complex components as member of the adrenergic neuroblastoma core regulatory circuitry
    Article Snippet: .. Sequencing depth IMR-32 SOX11 ChIP: Total mapped reads:75269021, Uniqually mapped reads: 58444500, Read length: 75 bp, single-end IMR-32 INPUT ChIP: Total mapped reads: 46283806, Uniqually mapped reads: 38101144, Read length: 75 bp, single-end IMR-32 SOX11 CUT&RUN: Total mapped reads: 9055406, Uniqually mapped reads: 6399393, Read length: 75 bp, pair-end IMR-32 IgG CUT&RUN: Total mapped reads: 8941165, Uniqually mapped reads: 5925768 Read length: 75 bp, pair-end CLB-GA SOX11 CUT&RUN: Total mapped reads: 9071586, Uniqually mapped reads: 6736893 Read length: 75 bp, pair-end CLB-GA IgG CUT&RUN: Total mapped reads: 8633535, Uniqually mapped reads: 594113, Read length: 75 bp, pair-end NGP SOX11 CUT&RUN: Total mapped reads: 9121804, Uniqually mapped reads: 6603935, Read length: 75 bp, pair-end NGP IgG CUT&RUN: Total mapped reads: 9118638, Uniqually mapped reads: 5897926, Read length: 75 bp, pair-end SH-EP SOX11 OE SOX11 CUT&RUN: Total mapped reads: 8509115, Uniqually mapped reads: 5373607, Read length: 75 bp, pair-end SH-EP SOX11 OE IgG CUT&RUN: Total mapped reads: 8247565, Uniqually mapped reads: 5869023, Read length: 75 bp, pair-end Antibodies CUT&RUN: anti-SOX11 antibody (HPA000536, Atlas Antibodies) and anti-IgG goat antibody (sc-2028, Santa Cruz Biotechnology) was used. .. ChIP: The rabbit polyclonal antibody, SOX11-PAb, was custom made (Absea biotechnology, China) against the immunogenic peptide p-SOX11C-term DDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPP PLAQPALSPASSRSVSTSSS Peak calling parameters Read mapping was done with bowtie2 and index hg19.

    Incubation:

    Article Title: A large-scale functional analysis of genes expressed differentially in insulin secreting MIN6 sublines with high versus mildly reduced glucose-responsiveness.
    Article Snippet: .. Membranes were probed with rabbit anti-Sox11 antibody (1:500) (HPA000536; Atlas Antibodies) or with mouse anti-β-actin antibody (1:5000) (#60008-1-Ig, Proteintech) overnight at 4 °C, and then incubated for 1 h with donkey anti-rabbit IgG (1:10,000) or with sheep anti-mouse IgG (1:10,000) conjugated with horseradish peroxidase (GE Healthcare, Piscataway, NL, USA). ..

    Article Title: A large-scale functional analysis of genes expressed differentially in insulin secreting MIN6 sublines with high versus mildly reduced glucose-responsiveness
    Article Snippet: .. Membranes were probed with rabbit anti-Sox11 antibody (1:500) (HPA000536; Atlas Antibodies) or with mouse anti-β-actin antibody (1:5000) (#60008-1-Ig, Proteintech) overnight at 4 °C, and then incubated for 1 h with donkey anti-rabbit IgG (1:10,000) or with sheep anti-mouse IgG (1:10,000) conjugated with horseradish peroxidase (GE Healthcare, Piscataway, NL, USA). ..

    Tissue:

    Article Title: CD5-negative Mantle Cell Lymphoma: Clinicopathologic features of an indolent variant that confers a survival advantage
    Article Snippet: .. Formalin-fixed paraffin-embedded tissue sections were stained for SOX11 (1:100; Atlas Antibodies, Stockholm, Sweden). ..



    Similar Products

    microarray human scleroderma data set  (Biotechnology Information)
    90
    Biotechnology Information microarray human scleroderma data set
    The IL-13 pathway is activated in SSc and sclGVHD skin. A: Gene expression data for the 491 IL-13–responsive genes identified in human dermal fibroblasts were extracted from the SSc skin data of Milano et al.4 SSc skin biopsy samples are ordered by intrinsic subset and genes are organized by hierarchical clustering. The centroid average of the IL-13–responsive gene signature at maximal induction (12 and 24 hours) is shown to the left of the heat map. Pearson's correlation coefficients between the centroid and individual patient sample are plotted below each array. B: Expression data for the 734 genes reported by Fulkerson et al26 as IL-13–inducible genes in mouse lung were extracted from the sclGVHD <t>microarray</t> data set obtained 2 weeks and 5 weeks after splenocyte transfer (n = 4 per group). Genes and arrays were organized by hierarchical clustering. The relative expression of IL-13–inducible genes (centroid) in lungs is shown to the left of the heat map. C: Representative IL-13 IHC on skin biopsies obtained from an SSc patient and a normal control subject. Arrowheads indicate IL-13+ cells. Original magnification, ×400. D: Blinded quantification of the number of IHC IL-13+ cells per high-power field (×600) in skin biopsies from SSc patients and normal control subjects. SSc, n = 18; control, n = 6; P = 0.0037. E: IL-13 ELISA on the tissue culture supernatants of skin explants from BALB/c Rag2−/− mice that received either syngeneic BALB/c (n = 3) or allogeneic B10.D2 (n = 3) splenocytes 2 weeks earlier (P = 0.002).
    Microarray Human Scleroderma Data Set, supplied by Biotechnology Information, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/microarray+human+scleroderma+data+set/microarray+human+scleroderma+data+set/pmc03349888-203-2-18
    Average 90 stars, based on 1 article reviews
    microarray human scleroderma data set - by Bioz Stars, 2026-11
    90/100 stars
    		  Buy from Supplier

    Image Search Results


    The IL-13 pathway is activated in SSc and sclGVHD skin. A: Gene expression data for the 491 IL-13–responsive genes identified in human dermal fibroblasts were extracted from the SSc skin data of Milano et al.4 SSc skin biopsy samples are ordered by intrinsic subset and genes are organized by hierarchical clustering. The centroid average of the IL-13–responsive gene signature at maximal induction (12 and 24 hours) is shown to the left of the heat map. Pearson's correlation coefficients between the centroid and individual patient sample are plotted below each array. B: Expression data for the 734 genes reported by Fulkerson et al26 as IL-13–inducible genes in mouse lung were extracted from the sclGVHD microarray data set obtained 2 weeks and 5 weeks after splenocyte transfer (n = 4 per group). Genes and arrays were organized by hierarchical clustering. The relative expression of IL-13–inducible genes (centroid) in lungs is shown to the left of the heat map. C: Representative IL-13 IHC on skin biopsies obtained from an SSc patient and a normal control subject. Arrowheads indicate IL-13+ cells. Original magnification, ×400. D: Blinded quantification of the number of IHC IL-13+ cells per high-power field (×600) in skin biopsies from SSc patients and normal control subjects. SSc, n = 18; control, n = 6; P = 0.0037. E: IL-13 ELISA on the tissue culture supernatants of skin explants from BALB/c Rag2−/− mice that received either syngeneic BALB/c (n = 3) or allogeneic B10.D2 (n = 3) splenocytes 2 weeks earlier (P = 0.002).

    Journal: The American Journal of Pathology

    Article Title: Interspecies Comparison of Human and Murine Scleroderma Reveals IL-13 and CCL2 as Disease Subset-Specific Targets

    doi: 10.1016/j.ajpath.2011.11.024

    Figure Lengend Snippet: The IL-13 pathway is activated in SSc and sclGVHD skin. A: Gene expression data for the 491 IL-13–responsive genes identified in human dermal fibroblasts were extracted from the SSc skin data of Milano et al.4 SSc skin biopsy samples are ordered by intrinsic subset and genes are organized by hierarchical clustering. The centroid average of the IL-13–responsive gene signature at maximal induction (12 and 24 hours) is shown to the left of the heat map. Pearson's correlation coefficients between the centroid and individual patient sample are plotted below each array. B: Expression data for the 734 genes reported by Fulkerson et al26 as IL-13–inducible genes in mouse lung were extracted from the sclGVHD microarray data set obtained 2 weeks and 5 weeks after splenocyte transfer (n = 4 per group). Genes and arrays were organized by hierarchical clustering. The relative expression of IL-13–inducible genes (centroid) in lungs is shown to the left of the heat map. C: Representative IL-13 IHC on skin biopsies obtained from an SSc patient and a normal control subject. Arrowheads indicate IL-13+ cells. Original magnification, ×400. D: Blinded quantification of the number of IHC IL-13+ cells per high-power field (×600) in skin biopsies from SSc patients and normal control subjects. SSc, n = 18; control, n = 6; P = 0.0037. E: IL-13 ELISA on the tissue culture supernatants of skin explants from BALB/c Rag2−/− mice that received either syngeneic BALB/c (n = 3) or allogeneic B10.D2 (n = 3) splenocytes 2 weeks earlier (P = 0.002).

    Article Snippet: The 75 microarray human scleroderma data set, previously described, 4 is publicly available at the National Center for Biotechnology Information GEO site ( http://www.ncbi.nlm.nih.gov/geo ; accession {"type":"entrez-geo","attrs":{"text":"GSE9285","term_id":"9285"}} GSE9285 ).

    Techniques: Gene Expression, Expressing, Microarray, Control, Enzyme-linked Immunosorbent Assay