sbm Search Results


90
Grameen Danone Foods Ltd sbm-grameen
Sbm Grameen, supplied by Grameen Danone Foods Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sbm-grameen/product/Grameen Danone Foods Ltd
Average 90 stars, based on 1 article reviews
sbm-grameen - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
SourceForge net source-based morphometry sbm v 1.0b
Source Based Morphometry Sbm V 1.0b, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/source-based morphometry sbm v 1.0b/product/SourceForge net
Average 90 stars, based on 1 article reviews
source-based morphometry sbm v 1.0b - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Chemie GmbH t-sbm
T Sbm, supplied by Chemie GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/t-sbm/product/Chemie GmbH
Average 90 stars, based on 1 article reviews
t-sbm - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
OptiGen LLC sbm or sr-u optigen ii
Sbm Or Sr U Optigen Ii, supplied by OptiGen LLC, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sbm or sr-u optigen ii/product/OptiGen LLC
Average 90 stars, based on 1 article reviews
sbm or sr-u optigen ii - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Solae LLC conventional dehulled sbm
Analyzed nutrient composition of corn, wheat, <t> soybean meal, </t> canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis
Conventional Dehulled Sbm, supplied by Solae LLC, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/conventional dehulled sbm/product/Solae LLC
Average 90 stars, based on 1 article reviews
conventional dehulled sbm - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
PROACT Medical Ltd sbm
Analyzed nutrient composition of corn, wheat, <t> soybean meal, </t> canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis
Sbm, supplied by PROACT Medical Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sbm/product/PROACT Medical Ltd
Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
FUJIFILM salbutamol (sbm
Analyzed nutrient composition of corn, wheat, <t> soybean meal, </t> canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis
Salbutamol (Sbm, supplied by FUJIFILM, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/salbutamol (sbm/product/FUJIFILM
Average 90 stars, based on 1 article reviews
salbutamol (sbm - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
DeGussa Corporation sbm
Analyzed nutrient composition of corn, wheat, <t> soybean meal, </t> canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis
Sbm, supplied by DeGussa Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sbm/product/DeGussa Corporation
Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
SBM Life Science bioadvanced insect, disease, and mite control
Analyzed nutrient composition of corn, wheat, <t> soybean meal, </t> canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis
Bioadvanced Insect, Disease, And Mite Control, supplied by SBM Life Science, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/bioadvanced insect, disease, and mite control/product/SBM Life Science
Average 90 stars, based on 1 article reviews
bioadvanced insect, disease, and mite control - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Genebiotech Co Ltd sbm
<t>SBM,</t> untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.
Sbm, supplied by Genebiotech Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sbm/product/Genebiotech Co Ltd
Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Biopeptide human dab2 sbm ( 24 skkekkkgpektdeyllarfkgdgvkykakligid 58 )
<t>SBM,</t> untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.
Human Dab2 Sbm ( 24 Skkekkkgpektdeyllarfkgdgvkykakligid 58 ), supplied by Biopeptide, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/human dab2 sbm ( 24 skkekkkgpektdeyllarfkgdgvkykakligid 58 )/product/Biopeptide
Average 90 stars, based on 1 article reviews
human dab2 sbm ( 24 skkekkkgpektdeyllarfkgdgvkykakligid 58 ) - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Rocha labs sbm
<t>SBM,</t> untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.
Sbm, supplied by Rocha labs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sbm/product/Rocha labs
Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

Image Search Results


Analyzed nutrient composition of corn, wheat,  soybean meal,  canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis

Journal: Journal of Animal Science

Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter

doi: 10.1093/jas/sky010

Figure Lengend Snippet: Analyzed nutrient composition of corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis

Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled SBM (Solae LLC, Gibson City, IL) and conventional canola meal (Dow AgroSciences, Indianapolis, IN) were obtained to represent oilseed meals that are used as protein sources in swine diets.

Techniques: Starch

Analyzed amino acid composition of corn, wheat,  soybean meal,  canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis

Journal: Journal of Animal Science

Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter

doi: 10.1093/jas/sky010

Figure Lengend Snippet: Analyzed amino acid composition of corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis

Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled SBM (Solae LLC, Gibson City, IL) and conventional canola meal (Dow AgroSciences, Indianapolis, IN) were obtained to represent oilseed meals that are used as protein sources in swine diets.

Techniques:

Analyzed mineral composition of corn, wheat,  soybean meal,  canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis

Journal: Journal of Animal Science

Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter

doi: 10.1093/jas/sky010

Figure Lengend Snippet: Analyzed mineral composition of corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis

Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled SBM (Solae LLC, Gibson City, IL) and conventional canola meal (Dow AgroSciences, Indianapolis, IN) were obtained to represent oilseed meals that are used as protein sources in swine diets.

Techniques:

Bulk density, swelling, WBC, and viscosity of corn, wheat,  soybean meal,  canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin

Journal: Journal of Animal Science

Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter

doi: 10.1093/jas/sky010

Figure Lengend Snippet: Bulk density, swelling, WBC, and viscosity of corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin

Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled SBM (Solae LLC, Gibson City, IL) and conventional canola meal (Dow AgroSciences, Indianapolis, IN) were obtained to represent oilseed meals that are used as protein sources in swine diets.

Techniques: Viscosity

IVAID and IVATTD of DM and OM in corn, wheat,  soybean meal,  canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin

Journal: Journal of Animal Science

Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter

doi: 10.1093/jas/sky010

Figure Lengend Snippet: IVAID and IVATTD of DM and OM in corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin

Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled SBM (Solae LLC, Gibson City, IL) and conventional canola meal (Dow AgroSciences, Indianapolis, IN) were obtained to represent oilseed meals that are used as protein sources in swine diets.

Techniques:

SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.

Journal: Journal of Animal Science and Technology

Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study

doi: 10.5187/jast.2024.e102

Figure Lengend Snippet: SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.

Article Snippet: The SBM and CA used for the in vitro experiments were provided by GeneBiotech (Gongju, Korea).

Techniques:

SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.

Journal: Journal of Animal Science and Technology

Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study

doi: 10.5187/jast.2024.e102

Figure Lengend Snippet: SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.

Article Snippet: The SBM and CA used for the in vitro experiments were provided by GeneBiotech (Gongju, Korea).

Techniques:

Differences in the rumen microbiota were compared using permutational multivariate analysis of variance. PC, principal component; SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.

Journal: Journal of Animal Science and Technology

Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study

doi: 10.5187/jast.2024.e102

Figure Lengend Snippet: Differences in the rumen microbiota were compared using permutational multivariate analysis of variance. PC, principal component; SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.

Article Snippet: The SBM and CA used for the in vitro experiments were provided by GeneBiotech (Gongju, Korea).

Techniques:

The visualized taxa include those with an occurrence rate of ≥ 30% and a relative abundance of ≥ 0.5% in at least one treatment. UCG represents an uncultured genus-level group, while UG denotes an unclassified genus. Others represent bacteria with an occurrence rate of < 30% and a relative abundance of < 0.5%. SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.

Journal: Journal of Animal Science and Technology

Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study

doi: 10.5187/jast.2024.e102

Figure Lengend Snippet: The visualized taxa include those with an occurrence rate of ≥ 30% and a relative abundance of ≥ 0.5% in at least one treatment. UCG represents an uncultured genus-level group, while UG denotes an unclassified genus. Others represent bacteria with an occurrence rate of < 30% and a relative abundance of < 0.5%. SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.

Article Snippet: The SBM and CA used for the in vitro experiments were provided by GeneBiotech (Gongju, Korea).

Techniques: Bacteria

Only major phyla with an occurrence rate of ≥ 30% and a relative abundance of ≥ 0.1% in at least one treatment were included in the evaluation. (A) Relative abundance of prokaryotic phyla, represented as mean ± standard error. Screening p -values were obtained using ANCOM-BC’s global test, with only significantly different phyla based on the p -values visualized. (B)–(G) Pairwise comparisons: (B) SBM vs. HSBM, (C) SBM vs. CSBM, (D) SBM vs. HCSBM, (E) HSBM vs. CSBM, (F) HSBM vs. HCSBM, and (G) CSBM vs. HCSBM. Data are shown as log fold change ± 95% confidence interval, with red symbols indicating significantly different phyla. SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal; ANCOM-BC, analysis of the composition of microbiomes with bias correction.

Journal: Journal of Animal Science and Technology

Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study

doi: 10.5187/jast.2024.e102

Figure Lengend Snippet: Only major phyla with an occurrence rate of ≥ 30% and a relative abundance of ≥ 0.1% in at least one treatment were included in the evaluation. (A) Relative abundance of prokaryotic phyla, represented as mean ± standard error. Screening p -values were obtained using ANCOM-BC’s global test, with only significantly different phyla based on the p -values visualized. (B)–(G) Pairwise comparisons: (B) SBM vs. HSBM, (C) SBM vs. CSBM, (D) SBM vs. HCSBM, (E) HSBM vs. CSBM, (F) HSBM vs. HCSBM, and (G) CSBM vs. HCSBM. Data are shown as log fold change ± 95% confidence interval, with red symbols indicating significantly different phyla. SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal; ANCOM-BC, analysis of the composition of microbiomes with bias correction.

Article Snippet: The SBM and CA used for the in vitro experiments were provided by GeneBiotech (Gongju, Korea).

Techniques:

Only major genera with an occurrence rate of ≥ 30% and a relative abundance of ≥ 0.1% in at least one treatment were included in the evaluation. (A) Relative abundance of prokaryotic genera, represented as mean ± standard error. Screening p -values were obtained using ANCOM-BC’s global test, with only significantly different genera based on p -values visualized. (B)–(G) Pairwise comparisons: (B) SBM vs. HSBM, (C) SBM vs. CSBM, (D) SBM vs. HCSBM, (E) HSBM vs. CSBM, (F) HSBM vs. HCSBM, and (G) CSBM vs. HCSBM. Data are shown as log fold change ± 95% confidence interval, with red symbols indicating significantly different genera, while a blue symbol indicates a statistical tendency. SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal; ANCOM-BC, analysis of the composition of microbiomes with bias correction.

Journal: Journal of Animal Science and Technology

Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study

doi: 10.5187/jast.2024.e102

Figure Lengend Snippet: Only major genera with an occurrence rate of ≥ 30% and a relative abundance of ≥ 0.1% in at least one treatment were included in the evaluation. (A) Relative abundance of prokaryotic genera, represented as mean ± standard error. Screening p -values were obtained using ANCOM-BC’s global test, with only significantly different genera based on p -values visualized. (B)–(G) Pairwise comparisons: (B) SBM vs. HSBM, (C) SBM vs. CSBM, (D) SBM vs. HCSBM, (E) HSBM vs. CSBM, (F) HSBM vs. HCSBM, and (G) CSBM vs. HCSBM. Data are shown as log fold change ± 95% confidence interval, with red symbols indicating significantly different genera, while a blue symbol indicates a statistical tendency. SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal; ANCOM-BC, analysis of the composition of microbiomes with bias correction.

Article Snippet: The SBM and CA used for the in vitro experiments were provided by GeneBiotech (Gongju, Korea).

Techniques:

(A) PCA plot based on KEGG orthologs. Only primary KEGG modules with a relative abundance of ≥ 0.01% in at least one treatment were assessed using ANCOM-BC. (B)-(G) Differentially enriched KEGG modules Data are shown as log-fold changes with 95% confidence intervals. Red symbols indicate significantly different KEGG modules, whereas blue symbols denote statistical tendencies. KEGG, Kyoto Encyclopedia of Genes and Genomes; PC, principal component; SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal; ANCOM-BC, analysis of the composition of microbiomes with bias correction; PCA, principal component analysis.

Journal: Journal of Animal Science and Technology

Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study

doi: 10.5187/jast.2024.e102

Figure Lengend Snippet: (A) PCA plot based on KEGG orthologs. Only primary KEGG modules with a relative abundance of ≥ 0.01% in at least one treatment were assessed using ANCOM-BC. (B)-(G) Differentially enriched KEGG modules Data are shown as log-fold changes with 95% confidence intervals. Red symbols indicate significantly different KEGG modules, whereas blue symbols denote statistical tendencies. KEGG, Kyoto Encyclopedia of Genes and Genomes; PC, principal component; SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal; ANCOM-BC, analysis of the composition of microbiomes with bias correction; PCA, principal component analysis.

Article Snippet: The SBM and CA used for the in vitro experiments were provided by GeneBiotech (Gongju, Korea).

Techniques: