sbm Search Results


t-sbm  (Chemie GmbH)
90
Chemie GmbH t-sbm
T Sbm, supplied by Chemie GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/t+sbm/10__1002_slash_anie__201206006-81-5-14
Average 90 stars, based on 1 article reviews
t-sbm - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
solabio neem bio-schädlingsfrei  (SBM Life Science)
90
SBM Life Science solabio neem bio-schädlingsfrei
Solabio Neem Bio Schädlingsfrei, supplied by SBM Life Science, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/solabio+neem+bio+sch%C3%A4dlingsfrei/pmc12268798-89-15-18
Average 90 stars, based on 1 article reviews
solabio neem bio-schädlingsfrei - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
sbm-tfc-039  (Sirona Biochem)
90
Sirona Biochem sbm-tfc-039
Sbm Tfc 039, supplied by Sirona Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/sbm+tfc+039/pmc04166348-124-7-35
Average 90 stars, based on 1 article reviews
sbm-tfc-039 - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
sbm broth todd-hewitt with gentamicin, nalidixic acid, 5% blood  (BioMedics Japan)
90
BioMedics Japan sbm broth todd-hewitt with gentamicin, nalidixic acid, 5% blood
Sbm Broth Todd Hewitt With Gentamicin, Nalidixic Acid, 5% Blood, supplied by BioMedics Japan, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/sbm+broth+todd+hewitt+with+gentamicin++nalidixic+acid++5++blood/10__1111_slash_j__1469___0691__2010__03239__x-777-5-14
Average 90 stars, based on 1 article reviews
sbm broth todd-hewitt with gentamicin, nalidixic acid, 5% blood - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
sbm  (CrossFit Inc)
90
CrossFit Inc sbm
Sbm, supplied by CrossFit Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/sbm/pmc11363260-207-9-6
Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
sbm - grameen (rural)  (Grameen Danone Foods Ltd)
90
Grameen Danone Foods Ltd sbm - grameen (rural)
Sbm Grameen (Rural), supplied by Grameen Danone Foods Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/sbm+grameen/10__9734_slash_ijpr_slash_2024_slash_v13i4302-87-6-8
Average 90 stars, based on 1 article reviews
sbm - grameen (rural) - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
sbm  (Adisseo France S.A.S)
90
Adisseo France S.A.S sbm
In vitro digestibility of <t>SBM</t> after 48-h hydrolysis by fungal secretomes. ( A ) Percentage of SBM residual matter. ( B ) Quantification of total proteins in the soluble fraction by the Bradford assay. ( C ) Quantification of free amino groups in the soluble fraction by the TNBS assay. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 2). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The <t>inducers</t> <t>(SBP</t> and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; D7, day 7; n.d., not detected; SBP, sugar beet pulp.
Sbm, supplied by Adisseo France S.A.S, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/sbm/pmc11409638-166-0-7
Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
fruit, citrus & vegetable insect control  (SBM Life Science)
90
SBM Life Science fruit, citrus & vegetable insect control
In vitro digestibility of <t>SBM</t> after 48-h hydrolysis by fungal secretomes. ( A ) Percentage of SBM residual matter. ( B ) Quantification of total proteins in the soluble fraction by the Bradford assay. ( C ) Quantification of free amino groups in the soluble fraction by the TNBS assay. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 2). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The <t>inducers</t> <t>(SBP</t> and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; D7, day 7; n.d., not detected; SBP, sugar beet pulp.
Fruit, Citrus & Vegetable Insect Control, supplied by SBM Life Science, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/fruit++citrus+++vegetable+insect+control/pmc06780620-85-2-12
Average 90 stars, based on 1 article reviews
fruit, citrus & vegetable insect control - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
heat-treated sbm with soyhulls  (Ag Processing Inc)
90
Ag Processing Inc heat-treated sbm with soyhulls
In vitro digestibility of <t>SBM</t> after 48-h hydrolysis by fungal secretomes. ( A ) Percentage of SBM residual matter. ( B ) Quantification of total proteins in the soluble fraction by the Bradford assay. ( C ) Quantification of free amino groups in the soluble fraction by the TNBS assay. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 2). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The <t>inducers</t> <t>(SBP</t> and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; D7, day 7; n.d., not detected; SBP, sugar beet pulp.
Heat Treated Sbm With Soyhulls, supplied by Ag Processing Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/heat+treated+sbm+with+soyhulls/10__3168_slash_jds__s0022___0302_ascii40_07_ascii41_71565___5-49-64-67
Average 90 stars, based on 1 article reviews
heat-treated sbm with soyhulls - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
human dab2 sbm (24skkekkkgpektdeyllarfkgdgvkykakligid58  (Biopeptide)
90
Biopeptide human dab2 sbm (24skkekkkgpektdeyllarfkgdgvkykakligid58
In vitro digestibility of <t>SBM</t> after 48-h hydrolysis by fungal secretomes. ( A ) Percentage of SBM residual matter. ( B ) Quantification of total proteins in the soluble fraction by the Bradford assay. ( C ) Quantification of free amino groups in the soluble fraction by the TNBS assay. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 2). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The <t>inducers</t> <t>(SBP</t> and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; D7, day 7; n.d., not detected; SBP, sugar beet pulp.
Human Dab2 Sbm (24skkekkkgpektdeyllarfkgdgvkykakligid58, supplied by Biopeptide, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/human+dab2+sbm+++24+skkekkkgpektdeyllarfkgdgvkykakligid+58++/10__1074_slash_jbc__m112__385609-48-5-12
Average 90 stars, based on 1 article reviews
human dab2 sbm (24skkekkkgpektdeyllarfkgdgvkykakligid58 - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
source-based morphometry sbm v 1.0b  (SourceForge net)
90
SourceForge net source-based morphometry sbm v 1.0b
In vitro digestibility of <t>SBM</t> after 48-h hydrolysis by fungal secretomes. ( A ) Percentage of SBM residual matter. ( B ) Quantification of total proteins in the soluble fraction by the Bradford assay. ( C ) Quantification of free amino groups in the soluble fraction by the TNBS assay. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 2). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The <t>inducers</t> <t>(SBP</t> and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; D7, day 7; n.d., not detected; SBP, sugar beet pulp.
Source Based Morphometry Sbm V 1.0b, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/source+based+morphometry+sbm+v+1+0b/pm36827943-79-6-19
Average 90 stars, based on 1 article reviews
source-based morphometry sbm v 1.0b - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
sbm  (AAFCO Inc)
90
AAFCO Inc sbm
In vitro digestibility of <t>SBM</t> after 48-h hydrolysis by fungal secretomes. ( A ) Percentage of SBM residual matter. ( B ) Quantification of total proteins in the soluble fraction by the Bradford assay. ( C ) Quantification of free amino groups in the soluble fraction by the TNBS assay. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 2). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The <t>inducers</t> <t>(SBP</t> and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; D7, day 7; n.d., not detected; SBP, sugar beet pulp.
Sbm, supplied by AAFCO Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sbm/sbm/pmc08244986-220-17-2
Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier

Image Search Results


In vitro digestibility of SBM after 48-h hydrolysis by fungal secretomes. ( A ) Percentage of SBM residual matter. ( B ) Quantification of total proteins in the soluble fraction by the Bradford assay. ( C ) Quantification of free amino groups in the soluble fraction by the TNBS assay. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 2). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The inducers (SBP and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; D7, day 7; n.d., not detected; SBP, sugar beet pulp.

Journal: Applied and Environmental Microbiology

Article Title: A time-course analysis of Aspergillus terreus secretomes reveals the importance of pectin-degrading enzymes to increase the digestibility of soybean meal

doi: 10.1128/aem.02153-23

Figure Lengend Snippet: In vitro digestibility of SBM after 48-h hydrolysis by fungal secretomes. ( A ) Percentage of SBM residual matter. ( B ) Quantification of total proteins in the soluble fraction by the Bradford assay. ( C ) Quantification of free amino groups in the soluble fraction by the TNBS assay. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 2). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The inducers (SBP and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; D7, day 7; n.d., not detected; SBP, sugar beet pulp.

Article Snippet: SBM and micronized SBP were provided by Adisseo France S.A.S.

Techniques: In Vitro, Bradford Assay, Control

Quantification of pectin monomers in the soluble fraction of SBM after 48-h hydrolysis. ( A ) Uronic acids. ( B ) Rhamnose. ( C ) Arabinose + galactose. ( D ) Fucose. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 3). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The inducers (SBP and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; n.d., not detected; SBP, sugar beet pulp.

Journal: Applied and Environmental Microbiology

Article Title: A time-course analysis of Aspergillus terreus secretomes reveals the importance of pectin-degrading enzymes to increase the digestibility of soybean meal

doi: 10.1128/aem.02153-23

Figure Lengend Snippet: Quantification of pectin monomers in the soluble fraction of SBM after 48-h hydrolysis. ( A ) Uronic acids. ( B ) Rhamnose. ( C ) Arabinose + galactose. ( D ) Fucose. All values are corrected by the control without enzyme and the control without substrate. Error bars correspond to standard deviations calculated from technical replicates ( n = 3). Statistical analyses were performed using analysis of variance and post hoc Tukey’s test. * P < 0.05, ** P < 0.01, *** P < 0.001. Hydrolysis tests were conducted at 37°C for 48 h. The inducers (SBP and BP) and the time of secretome harvest (D3, D5, and D7) are indicated. BP, banana peel; n.d., not detected; SBP, sugar beet pulp.

Article Snippet: SBM and micronized SBP were provided by Adisseo France S.A.S.

Techniques: Control