polr2h Search Results


polr2h proteintech rabbit  (Proteintech)
93
Proteintech polr2h proteintech rabbit
Polr2h Proteintech Rabbit, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/polr2h/pmc12043920__41598_2025_97727_MOESM1_ESM-11-18-19?v=Proteintech
Average 93 stars, based on 1 article reviews
polr2h proteintech rabbit - by Bioz Stars, 2026-08
93/100 stars
  Buy from Supplier
rna pol ii subunits polr2g, polr2h, pol2l  (TranScrip Partners)
90
TranScrip Partners rna pol ii subunits polr2g, polr2h, pol2l
Rna Pol Ii Subunits Polr2g, Polr2h, Pol2l, supplied by TranScrip Partners, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/polr2h/pmc05946721__mmc4-128-19-20?v=TranScrip+Partners
Average 90 stars, based on 1 article reviews
rna pol ii subunits polr2g, polr2h, pol2l - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier
rabbit-anti-polr2h (rpab3  (WuXi AppTec)
90
WuXi AppTec rabbit-anti-polr2h (rpab3
Identification of miR-1825 targets by proteomic and transcriptomic profiling. a Experimental design for miR-1825 target identification. b Representative western blots of HEK293 cells used for densitometric analysis shown in c. c Densitometric quantification of western blots of HEK293 cells 48 h post-transfection with mimic-1825, antimiR-1825 or the corresponding control RNAs. Levels of TBCB (n = 5), CASP3 (n = 5) and <t>RPAB3</t> (n = 7) were normalized to β-actin. d Hierarchical cluster analysis (average linkage) of all RNAs detected by microarray analysis of HEK293 cells transfected with mimic-1825 or the respective control RNA (mimic-ctrl.; n = 6 biological replicates per condition). e QRT-PCR validation of mRNA levels of proteins found to be downregulated (CASP3, TBCB, RPAB3), unaltered (DDX3, XPO7, PFN1) or upregulated (EDC3, DDX24, CPSF7) upon mimic-1825 transfection by mass spectrometry (n = 6 biological replicates). QRT-PCR measurements were carried out 24 h post-transfection and Ct values were normalized to TBP (bars in c and e indicate mean ± SEM; *p < 0.05, **p < 0.01, ***p < 0.001 in a two-tailed Student’s t test; ns not significant)
Rabbit Anti Polr2h (Rpab3, supplied by WuXi AppTec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/polr2h/pmc11105367-112-33-36?v=WuXi+AppTec
Average 90 stars, based on 1 article reviews
rabbit-anti-polr2h (rpab3 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier
anti polr2h antibody  (Abnova)
90
Abnova anti polr2h antibody
Identification of miR-1825 targets by proteomic and transcriptomic profiling. a Experimental design for miR-1825 target identification. b Representative western blots of HEK293 cells used for densitometric analysis shown in c. c Densitometric quantification of western blots of HEK293 cells 48 h post-transfection with mimic-1825, antimiR-1825 or the corresponding control RNAs. Levels of TBCB (n = 5), CASP3 (n = 5) and <t>RPAB3</t> (n = 7) were normalized to β-actin. d Hierarchical cluster analysis (average linkage) of all RNAs detected by microarray analysis of HEK293 cells transfected with mimic-1825 or the respective control RNA (mimic-ctrl.; n = 6 biological replicates per condition). e QRT-PCR validation of mRNA levels of proteins found to be downregulated (CASP3, TBCB, RPAB3), unaltered (DDX3, XPO7, PFN1) or upregulated (EDC3, DDX24, CPSF7) upon mimic-1825 transfection by mass spectrometry (n = 6 biological replicates). QRT-PCR measurements were carried out 24 h post-transfection and Ct values were normalized to TBP (bars in c and e indicate mean ± SEM; *p < 0.05, **p < 0.01, ***p < 0.001 in a two-tailed Student’s t test; ns not significant)
Anti Polr2h Antibody, supplied by Abnova, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/polr2h/pm22149079-30-7-9?v=Abnova
Average 90 stars, based on 1 article reviews
anti polr2h antibody - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier
polr2h gene  (Gallus BioPharmaceuticals)
90
Gallus BioPharmaceuticals polr2h gene
Identification of miR-1825 targets by proteomic and transcriptomic profiling. a Experimental design for miR-1825 target identification. b Representative western blots of HEK293 cells used for densitometric analysis shown in c. c Densitometric quantification of western blots of HEK293 cells 48 h post-transfection with mimic-1825, antimiR-1825 or the corresponding control RNAs. Levels of TBCB (n = 5), CASP3 (n = 5) and <t>RPAB3</t> (n = 7) were normalized to β-actin. d Hierarchical cluster analysis (average linkage) of all RNAs detected by microarray analysis of HEK293 cells transfected with mimic-1825 or the respective control RNA (mimic-ctrl.; n = 6 biological replicates per condition). e QRT-PCR validation of mRNA levels of proteins found to be downregulated (CASP3, TBCB, RPAB3), unaltered (DDX3, XPO7, PFN1) or upregulated (EDC3, DDX24, CPSF7) upon mimic-1825 transfection by mass spectrometry (n = 6 biological replicates). QRT-PCR measurements were carried out 24 h post-transfection and Ct values were normalized to TBP (bars in c and e indicate mean ± SEM; *p < 0.05, **p < 0.01, ***p < 0.001 in a two-tailed Student’s t test; ns not significant)
Polr2h Gene, supplied by Gallus BioPharmaceuticals, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/polr2h/pm23070920-26-8-28?v=Gallus+BioPharmaceuticals
Average 90 stars, based on 1 article reviews
polr2h gene - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier
polr2h rat sirna oligo duplex  (OriGene)
N/A
Polr2h Rat 3 unique 27mer siRNA duplexes 2 nmol each
   Buy from Supplier
polr2h mouse monoclonal antibody  (OriGene)
N/A
POLR2H mouse monoclonal antibody clone OTI1C10 Biotinylated
   Buy from Supplier
polr2h bc092087 mouse tagged orf clone  (OriGene)
N/A
Lenti ORF clone of Polr2h Myc DDK tagged Mouse polymerase RNA II DNA directed polypeptide H cDNA clone MGC 103049 IMAGE 5042770
   Buy from Supplier
polr2h monoclonal antibody oti1c10  (Thermo Fisher)
N/A
POLR2H Monoclonal Antibody for Western Blot
   Buy from Supplier
polr2h antibody  (Biosynth Carbosynth)
N/A
POLR2H antibody was raised using the N terminal of POLR2H corresponding to a region with amino acids DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE. Rabbit polyclonal POLR2H antibody raised against the N terminal of POLR2H.
   Buy from Supplier
polr2h human shrna plasmid kit  (OriGene)
N/A
POLR2H Human 4 unique 29mer shRNA constructs in lentiviral GFP vector
   Buy from Supplier

Image Search Results


Identification of miR-1825 targets by proteomic and transcriptomic profiling. a Experimental design for miR-1825 target identification. b Representative western blots of HEK293 cells used for densitometric analysis shown in c. c Densitometric quantification of western blots of HEK293 cells 48 h post-transfection with mimic-1825, antimiR-1825 or the corresponding control RNAs. Levels of TBCB (n = 5), CASP3 (n = 5) and RPAB3 (n = 7) were normalized to β-actin. d Hierarchical cluster analysis (average linkage) of all RNAs detected by microarray analysis of HEK293 cells transfected with mimic-1825 or the respective control RNA (mimic-ctrl.; n = 6 biological replicates per condition). e QRT-PCR validation of mRNA levels of proteins found to be downregulated (CASP3, TBCB, RPAB3), unaltered (DDX3, XPO7, PFN1) or upregulated (EDC3, DDX24, CPSF7) upon mimic-1825 transfection by mass spectrometry (n = 6 biological replicates). QRT-PCR measurements were carried out 24 h post-transfection and Ct values were normalized to TBP (bars in c and e indicate mean ± SEM; *p < 0.05, **p < 0.01, ***p < 0.001 in a two-tailed Student’s t test; ns not significant)

Journal: Cellular and Molecular Life Sciences: CMLS

Article Title: Dysregulation of a novel miR-1825/TBCB/TUBA4A pathway in sporadic and familial ALS

doi: 10.1007/s00018-018-2873-1

Figure Lengend Snippet: Identification of miR-1825 targets by proteomic and transcriptomic profiling. a Experimental design for miR-1825 target identification. b Representative western blots of HEK293 cells used for densitometric analysis shown in c. c Densitometric quantification of western blots of HEK293 cells 48 h post-transfection with mimic-1825, antimiR-1825 or the corresponding control RNAs. Levels of TBCB (n = 5), CASP3 (n = 5) and RPAB3 (n = 7) were normalized to β-actin. d Hierarchical cluster analysis (average linkage) of all RNAs detected by microarray analysis of HEK293 cells transfected with mimic-1825 or the respective control RNA (mimic-ctrl.; n = 6 biological replicates per condition). e QRT-PCR validation of mRNA levels of proteins found to be downregulated (CASP3, TBCB, RPAB3), unaltered (DDX3, XPO7, PFN1) or upregulated (EDC3, DDX24, CPSF7) upon mimic-1825 transfection by mass spectrometry (n = 6 biological replicates). QRT-PCR measurements were carried out 24 h post-transfection and Ct values were normalized to TBP (bars in c and e indicate mean ± SEM; *p < 0.05, **p < 0.01, ***p < 0.001 in a two-tailed Student’s t test; ns not significant)

Article Snippet: Primary antibodies were rabbit-anti-Caspase3 (#9662, Cell Signaling Technology, 1:1000), rabbit-anti-TBCB (#PA03169A0Rb, Cusabio Life science, 1:1000), rabbit-anti-TUBA4A (# P68366 , Abgent, 1:8000), rabbit-anti-TUBA4A (#ab8374, Abcam, 1:500), mouse-anti-myc tag (9B11, #2276, Cell Signaling Technology, 1:2000), rabbit-anti-POLR2H (RPAB3) (#AP20815a, Abgent, 1:1000), rabbit-anti-β-tubulin (D2N5G, #15115, Cell Signaling Technology, 1:1000), rabbit-anti-TUBA1A/TUBA1B/TUBA1C/TUBA8/TUBA4A (#PA-193238, Cusabio Life science, 1:1000), rabbit-anti-TUBA1A (#ab200216, Abcam, 1:1000), rabbit-anti-tuba8l2 (#orb53155, biorbyt, 1:2000), rabbit-anti-GAPDH (#10494-1-AP, proteintech, 1:5000) and rabbit-anti-β-actin (13E5, #4970S, Cell Signaling Technology, 1:2000).

Techniques: Western Blot, Transfection, Microarray, Quantitative RT-PCR, Mass Spectrometry, Two Tailed Test