90
|
GenScript corporation
alkynyl-terminated phlip Alkynyl Terminated Phlip, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/alkynyl-terminated phlip/product/GenScript corporation Average 90 stars, based on 1 article reviews
alkynyl-terminated phlip - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
phlip peptide (a c eqnpiywarya d wlfttpllll d lallvdadegtg) Phlip Peptide (A C Eqnpiywarya D Wlfttpllll D Lallvdadegtg), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/phlip peptide (a c eqnpiywarya d wlfttpllll d lallvdadegtg)/product/GenScript corporation Average 90 stars, based on 1 article reviews
phlip peptide (a c eqnpiywarya d wlfttpllll d lallvdadegtg) - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
SourceForge net
auto-phlip-ml Auto Phlip Ml, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/auto-phlip-ml/product/SourceForge net Average 90 stars, based on 1 article reviews
auto-phlip-ml - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
DaVinci Biosciences
icg var3 phlip davinci si surgical system Icg Var3 Phlip Davinci Si Surgical System, supplied by DaVinci Biosciences, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/icg var3 phlip davinci si surgical system/product/DaVinci Biosciences Average 90 stars, based on 1 article reviews
icg var3 phlip davinci si surgical system - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
SourceForge net
phlip software Phlip Software, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/phlip software/product/SourceForge net Average 90 stars, based on 1 article reviews
phlip software - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
CS Bio Inc
phlip® variant 3 (var3) peptide Phlip® Variant 3 (Var3) Peptide, supplied by CS Bio Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/phlip® variant 3 (var3) peptide/product/CS Bio Inc Average 90 stars, based on 1 article reviews
phlip® variant 3 (var3) peptide - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
GL Biochem
phlip-cys Phlip Cys, supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/phlip-cys/product/GL Biochem Average 90 stars, based on 1 article reviews
phlip-cys - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
alkynyl-terminated phlip sequence “ceeqqpwaqylellfptetlllewg Alkynyl Terminated Phlip Sequence “Ceeqqpwaqylellfptetlllewg, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/alkynyl-terminated phlip sequence “ceeqqpwaqylellfptetlllewg/product/GenScript corporation Average 90 stars, based on 1 article reviews
alkynyl-terminated phlip sequence “ceeqqpwaqylellfptetlllewg - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
CS Bio Inc
phlip-cys Phlip Cys, supplied by CS Bio Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/phlip-cys/product/CS Bio Inc Average 90 stars, based on 1 article reviews
phlip-cys - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
CS Bio Inc
no2a-variant 3 phlip No2a Variant 3 Phlip, supplied by CS Bio Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/no2a-variant 3 phlip/product/CS Bio Inc Average 90 stars, based on 1 article reviews
no2a-variant 3 phlip - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
GL Biochem
nh2-aeqnpiywaryadwlfttplllldlallvdadegt (phlip Nh2 Aeqnpiywaryadwlfttplllldlallvdadegt (Phlip, supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/nh2-aeqnpiywaryadwlfttplllldlallvdadegt (phlip/product/GL Biochem Average 90 stars, based on 1 article reviews
nh2-aeqnpiywaryadwlfttplllldlallvdadegt (phlip - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
Bankpeptide biological technology co LTD
phlip (aceqnpiywaryadwlfttplllldlallvdadegt)  Phlip (Aceqnpiywaryadwlfttplllldlallvdadegt), supplied by Bankpeptide biological technology co LTD, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/phlip (aceqnpiywaryadwlfttplllldlallvdadegt)/product/Bankpeptide biological technology co LTD Average 90 stars, based on 1 article reviews
phlip (aceqnpiywaryadwlfttplllldlallvdadegt) - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
Image Search Results
Journal: Theranostics
Article Title: pH- and photothermal-driven multistage delivery nanoplatform for overcoming cancer drug resistance
doi: 10.7150/thno.33958
Figure Lengend Snippet: Characterization of pPGNCs. (A) Microstructure and element composition of GNCs, PGNCs and pPGNC. (B) Fluorescence spectra of GNCs, pHLIP, PGNCs and pPGNCs at the excitation wavelength of 280 nm. (C) CD spectra of GNCs, pHLIP, PGNCs and pPGNCs. (D) TGA analysis of POEG, GNCs, PGNCs and pPGNCs. (E) Diameter change of GNCs and pPGNCs incubating in PBS at the different temperatures. The data are presented as the mean ± SD (n = 3).
Article Snippet: DMEM, RPMI 1640 and fetal bovine serum (FBS) were obtained from Gibco BRL/Life Technologies (Grand Island, NY, USA).
Techniques: Fluorescence, Circular Dichroism