Journal: Journal of Anatomy

Article Title: Morphology of GNAT 3‐immunoreactive chemosensory cells in the rat larynx

doi: 10.1111/joa.12914

Figure Lengend Snippet: Primary and secondary antibodies used in the present study

Article Snippet: Immunohistochemistry Details of the antibodies used in the present study and their combinations are shown in Tables and , respectively. table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 No. Antibody against Antigen Manufacturer; host; catalog number; RRID Dilution Function; Immunohistochemical marker for Primary antibodies GNAT3 Synthetic peptide (KNQFLDLNLKKEDKE), 304–318 amino acid sequence of human GNAT3 Abcam (Cambridge, UK); goat; ab113664; AB_10866449 1,2,000 Taste signaling protein; Chemosensory cells Synaptosomal‐associated protein 25 kD (SNAP25) Crude human synaptic immunoprecipitated (Characterized by Honer et al. 1993) Bio‐Rad (Hercules, CA, USA); mouse (monoclonal); MCA1308; AB_322417 1:2,000 SNARE protein; Neuroendocrine cells and certain nerve fibers Espin Recombinant protein (SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK), 123–182 amino acid sequence of human espin Novus Biologicals (Littleton, CO, USA); rabbit; NBP1‐90588; AB_11015490 1:100 Actin‐binding protein; Certain microvilli P2X3 ATP receptor (P2X3) Synthetic peptide (VEKQSTDGAYSIGH),383–397 amino acid sequence of rat P2X3 Neuromics (Edina, MN, USA); rabbit; RA10109; AB_2157930 1:4,000 Ionotropic ATP receptor; Certain sensory nerves Secondary antibodies a Alexa Fluor 488‐labeled anti‐goat IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 705‐545‐147; AB_2336933 1:200 b Alexa Fluor 488‐labeled anti‐rabbit IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 711‐545‐152; AB_2313584 1:200 c Cy3‐labeled anti‐mouse IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 715‐165‐151; AB_2315777 1:100 d Cy3‐labeled anti‐rabbit IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 711‐165‐152; AB_2307443 1:100 e Cy3‐labeled anti‐goat IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 705‐165‐147; AB_2307351 1:100 f Alexa Fluor 647‐labeled anti‐mouse IgG Jackson ImmunoResearch (West Grove, PA, USA); donkey; 715‐605‐150; AB_2340862 1:100 Open in a separate window The antibody numbers and symbols in this table are also used in Table .

Techniques: Immunohistochemical staining, Marker, Sequencing, Immunoprecipitation, Recombinant

Journal: Frontiers in Immunology

Article Title: Interleukin-1 signaling and CD4 + T cells control B cell recruitment to the lungs in chronic beryllium disease

doi: 10.3389/fimmu.2025.1479348

Figure Lengend Snippet: IL-1R1 signaling controls BeO-induced B cell recruitment to the lungs. Wildtype (WT) and interleukin-1 receptor 1 knockout (IL-1R1 -/- ) mice were exposed to BeO and sacrificed on day 21. (A) Flow cytometry plots show the recruitment of adaptive immune cells in the lungs of PBS or BeO-exposed mice. Graph plots show a total number of tissue-specific B220+ B cells (B) and neutrophils (C) in the lungs of PBS and BeO exposed WT and IL-1R1 -/- mice on day 21. (D) Total protein concentration in the BALF measured by BCA, and (E) CXCL13 levels in the BALF on day 21 measured by ELISA. (F) Hematoxylin and eosin (H&E) staining of BeO-exposed lung tissues from WT (top) and IL-1R1 -/- (bottom) mice. (G) Cellular aggregates in the lungs of WT and IL-1R1 -/- mice exposed to BeO were quantified using QuPath. Data are representative of three independent experiments having n=5 mice per group. One-way ANOVA was used to test statistical differences among the groups. P<0.05 (*) is considered statistically significant. P < 0.01 (**), P < 0.001 (***), P < 0.0001 (****).

Article Snippet: Briefly, each section was stained with Hematoxylin and eosin, and for B cell staining, a 1:10000 dilution of rabbit anti-B220 (Novus Biologicals, RA3-6B2) was applied using a Bond RX automated stainer (Leica Biosystems).

Techniques: Knock-Out, Flow Cytometry, Protein Concentration, Enzyme-linked Immunosorbent Assay, Staining

Journal: Frontiers in Immunology

Article Title: Interleukin-1 signaling and CD4 + T cells control B cell recruitment to the lungs in chronic beryllium disease

doi: 10.3389/fimmu.2025.1479348

Figure Lengend Snippet: Adoptively transferred B cells protect against BeO-induced lung injury. μMT mice were adoptively transferred with wild-type B cells purified from the spleen or with splenocytes from μMT mice. Recipient mice were sensitized and boosted with BeO using the previously described protocol. Percent frequency (A) and total number of B cells (B) in the BAL of BeO-exposed mice as examined on day 21. (C) Protein leak in the bronchoalveolar lavage fluid (BALF) of μMT mice adoptively transferred with WT splenic B cells or μMT splenocytes and exposed to BeO on day 21. (D) Hematoxylin and eosin staining show low magnification (top) and high magnification (bottom), and (E) cellular aggregates quantified in the lungs of mice adoptively transferred with WT splenic B cells or splenocytes from μMT mice into μMT mice and exposed to BeO. Cellular aggregates were quantified using QuPath. (F) Immunohistochemical (IHC) staining of B cells low magnification (top) and high magnification (bottom) on day 21 using an anti-rabbit B cell antibody in the lungs of mice adoptively transferred with WT splenic B cells or splenocytes from μMT mice into μMT mice and exposed to BeO. Data are representative of three independent experiments, 3-5 mice per group. One-way ANOVA was used to test statistical differences among the groups. P<0.05 (*) is considered statistically significant. P < 0.01 (**), P

Article Snippet: Briefly, each section was stained with Hematoxylin and eosin, and for B cell staining, a 1:10000 dilution of rabbit anti-B220 (Novus Biologicals, RA3-6B2) was applied using a Bond RX automated stainer (Leica Biosystems).

Techniques: Purification, Staining, Immunohistochemical staining, Immunohistochemistry

Journal: Frontiers in Immunology

Article Title: Interleukin-1 signaling and CD4 + T cells control B cell recruitment to the lungs in chronic beryllium disease

doi: 10.3389/fimmu.2025.1479348

Figure Lengend Snippet: CXCR5 expression is required for B cell recruitment to the lung in response to BeO exposure. WT and CXCR5 -/- mice were sensitized with seven doses of BeO (100 μg) on days 0, 1, 2, 14, 15, 18, and 19 and sacrificed on day 21. (A) Representative dot plot shows the presence of CD19 + and CD3 + T cells and (B) cumulative percent frequency (left) and total number (right) of B cells in the BAL of BeO-exposed mice. (C) Percent frequency (left) and the total number of CD3 + T cells (right) in the BAL of BeO-exposed WT and CXCR5 -/- mice on day 21. (D) Hematoxylin and eosin staining and (E) immunohistochemical (IHC) staining of B cells using an anti-rabbit B cell antibody of BeO-exposed lung tissues. (F) Cellular aggregates in the lungs of WT and CXCR5 -/- mice were quantified using QuPath. Data are representative of three independent experiments, 4-5 mice per group. One-way ANOVA was used to test statistical differences among the groups. P<0.05 (*) is considered statistically significant. P < 0.05 (*), P < 0.01 (**), P < 0.001 (***), P < 0.0001 (****).

Article Snippet: Briefly, each section was stained with Hematoxylin and eosin, and for B cell staining, a 1:10000 dilution of rabbit anti-B220 (Novus Biologicals, RA3-6B2) was applied using a Bond RX automated stainer (Leica Biosystems).

Techniques: Expressing, Staining, Immunohistochemical staining, Immunohistochemistry