chrm1 Search Results


93
Alomone Labs m 1 machr
M 1 Machr, supplied by Alomone Labs, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/m 1 machr/product/Alomone Labs
Average 93 stars, based on 1 article reviews
m 1 machr - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier

96
Thermo Fisher gene exp chrm1 rn00589936 s1
Gene Exp Chrm1 Rn00589936 S1, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/gene exp chrm1 rn00589936 s1/product/Thermo Fisher
Average 96 stars, based on 1 article reviews
gene exp chrm1 rn00589936 s1 - by Bioz Stars, 2026-03
96/100 stars
  Buy from Supplier

91
Alomone Labs anti m1 muscarinic acetylcholine receptor
Antibody details
Anti M1 Muscarinic Acetylcholine Receptor, supplied by Alomone Labs, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/anti m1 muscarinic acetylcholine receptor/product/Alomone Labs
Average 91 stars, based on 1 article reviews
anti m1 muscarinic acetylcholine receptor - by Bioz Stars, 2026-03
91/100 stars
  Buy from Supplier

94
Novus Biologicals primary antibodies against m1
FIGURE 1 Outline of the experimental design. Study 1 evaluated the impact of systemic xanomeline (XAN) on behavioural responses related to TS and comorbid disorders. Study 2 was designed to evaluate the involvement of M4 receptors in the effects of XAN, leveraging the selective M4 antagonist, VU06028418 and the M4 positive allosteric modulator (PAM), VU0467154. Study 3 was designed to evaluate the involvement of <t>M1</t> receptors in the effects of XAN, using the selective M1 antagonist, VU0255035 and cevimeline (CEV), a muscarinic agonist with high affinity and potency on M1 and M3 but not M4 receptors. Study 4 evaluated the involvement of the dorsal striatum in the behavioural effects of XAN. Study 5 was used for the neurochemical investigations. The timelines for treatments and procedures are outlined in each panel. Abbreviations: PPI, prepulse inhibition of the acoustic startle. WB, western blotting. IF, immunofluorescence. For further details, see text.
Primary Antibodies Against M1, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/primary antibodies against m1/product/Novus Biologicals
Average 94 stars, based on 1 article reviews
primary antibodies against m1 - by Bioz Stars, 2026-03
94/100 stars
  Buy from Supplier

86
Thermo Fisher gene exp chrm1 hs00265195 s1
FIGURE 1 Outline of the experimental design. Study 1 evaluated the impact of systemic xanomeline (XAN) on behavioural responses related to TS and comorbid disorders. Study 2 was designed to evaluate the involvement of M4 receptors in the effects of XAN, leveraging the selective M4 antagonist, VU06028418 and the M4 positive allosteric modulator (PAM), VU0467154. Study 3 was designed to evaluate the involvement of <t>M1</t> receptors in the effects of XAN, using the selective M1 antagonist, VU0255035 and cevimeline (CEV), a muscarinic agonist with high affinity and potency on M1 and M3 but not M4 receptors. Study 4 evaluated the involvement of the dorsal striatum in the behavioural effects of XAN. Study 5 was used for the neurochemical investigations. The timelines for treatments and procedures are outlined in each panel. Abbreviations: PPI, prepulse inhibition of the acoustic startle. WB, western blotting. IF, immunofluorescence. For further details, see text.
Gene Exp Chrm1 Hs00265195 S1, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/gene exp chrm1 hs00265195 s1/product/Thermo Fisher
Average 86 stars, based on 1 article reviews
gene exp chrm1 hs00265195 s1 - by Bioz Stars, 2026-03
86/100 stars
  Buy from Supplier

94
OriGene sr300807

Sr300807, supplied by OriGene, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sr300807/product/OriGene
Average 94 stars, based on 1 article reviews
sr300807 - by Bioz Stars, 2026-03
94/100 stars
  Buy from Supplier

87
Thermo Fisher gene exp chrm1 mm00432509 s1

Gene Exp Chrm1 Mm00432509 S1, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 87/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/gene exp chrm1 mm00432509 s1/product/Thermo Fisher
Average 87 stars, based on 1 article reviews
gene exp chrm1 mm00432509 s1 - by Bioz Stars, 2026-03
87/100 stars
  Buy from Supplier

92
Addgene inc chrm1 tango

Chrm1 Tango, supplied by Addgene inc, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/chrm1 tango/product/Addgene inc
Average 92 stars, based on 1 article reviews
chrm1 tango - by Bioz Stars, 2026-03
92/100 stars
  Buy from Supplier

85
Thermo Fisher gene exp chrm1 mm01231010 m1

Gene Exp Chrm1 Mm01231010 M1, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 85/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/gene exp chrm1 mm01231010 m1/product/Thermo Fisher
Average 85 stars, based on 1 article reviews
gene exp chrm1 mm01231010 m1 - by Bioz Stars, 2026-03
85/100 stars
  Buy from Supplier

86
Thermo Fisher gene exp chrm1 hs00912795 m1

Gene Exp Chrm1 Hs00912795 M1, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/gene exp chrm1 hs00912795 m1/product/Thermo Fisher
Average 86 stars, based on 1 article reviews
gene exp chrm1 hs00912795 m1 - by Bioz Stars, 2026-03
86/100 stars
  Buy from Supplier

86
Thermo Fisher gene exp chrm1 ss03393581 u1
TaqMan gene expression assays used for real-time PCR expression analysis
Gene Exp Chrm1 Ss03393581 U1, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/gene exp chrm1 ss03393581 u1/product/Thermo Fisher
Average 86 stars, based on 1 article reviews
gene exp chrm1 ss03393581 u1 - by Bioz Stars, 2026-03
86/100 stars
  Buy from Supplier

Image Search Results


Antibody details

Journal: Brain and Behavior

Article Title: Most calbindin‐immunoreactive neurons, but few calretinin‐immunoreactive neurons, express the m1 acetylcholine receptor in the middle temporal visual area of the macaque monkey

doi: 10.1002/brb3.1071

Figure Lengend Snippet: Antibody details

Article Snippet: Anti‐m1 muscarinic acetylcholine receptor , GST fusion protein corresponding to aa227‐353 of human m1 ACh receptor (GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGESVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK) , Alomone Labs (Jerusalem, Israel). Rabbit polyclonal. Catalog#AMR‐001 Lot#AN‐05 http://scicrunch.org/resolver/AB_2039993 , 1:1,000.

Techniques: Purification, Recombinant

Quantification methods. The figure (a) shows m1 acetylcholine receptor immunoreactivity. Cells marked with a circle met counting criteria and were counted. The figure (b) shows immunoreactivity for calbindin‐D28k. Within this population are two subgroups: cells with darkly stained somata (marked with squares) and cells with faintly stained somata (marked with arrows). Only darkly stained cells were quantified. The merged image in (c) shows cells that were counted in both single‐label images, and thus are counted as dual‐labeled cells. Scale bar = 25 µm (all panels)

Journal: Brain and Behavior

Article Title: Most calbindin‐immunoreactive neurons, but few calretinin‐immunoreactive neurons, express the m1 acetylcholine receptor in the middle temporal visual area of the macaque monkey

doi: 10.1002/brb3.1071

Figure Lengend Snippet: Quantification methods. The figure (a) shows m1 acetylcholine receptor immunoreactivity. Cells marked with a circle met counting criteria and were counted. The figure (b) shows immunoreactivity for calbindin‐D28k. Within this population are two subgroups: cells with darkly stained somata (marked with squares) and cells with faintly stained somata (marked with arrows). Only darkly stained cells were quantified. The merged image in (c) shows cells that were counted in both single‐label images, and thus are counted as dual‐labeled cells. Scale bar = 25 µm (all panels)

Article Snippet: Anti‐m1 muscarinic acetylcholine receptor , GST fusion protein corresponding to aa227‐353 of human m1 ACh receptor (GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGESVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK) , Alomone Labs (Jerusalem, Israel). Rabbit polyclonal. Catalog#AMR‐001 Lot#AN‐05 http://scicrunch.org/resolver/AB_2039993 , 1:1,000.

Techniques: Staining, Labeling

Laminar distributions of cells immunoreactive for the m1 acetylcholine receptor (a), calbindin‐D28k (b), and calretinin (c). Layer boundaries are marked to the left of each panel. m1‐immunoreactive neurons are more uniformly distributed throughout the tissue than are CB ‐ and CR ‐immunoreactive neurons, which are mostly expressed in layers II and III . Scale bar = 50 µm (all panels)

Journal: Brain and Behavior

Article Title: Most calbindin‐immunoreactive neurons, but few calretinin‐immunoreactive neurons, express the m1 acetylcholine receptor in the middle temporal visual area of the macaque monkey

doi: 10.1002/brb3.1071

Figure Lengend Snippet: Laminar distributions of cells immunoreactive for the m1 acetylcholine receptor (a), calbindin‐D28k (b), and calretinin (c). Layer boundaries are marked to the left of each panel. m1‐immunoreactive neurons are more uniformly distributed throughout the tissue than are CB ‐ and CR ‐immunoreactive neurons, which are mostly expressed in layers II and III . Scale bar = 50 µm (all panels)

Article Snippet: Anti‐m1 muscarinic acetylcholine receptor , GST fusion protein corresponding to aa227‐353 of human m1 ACh receptor (GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGESVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK) , Alomone Labs (Jerusalem, Israel). Rabbit polyclonal. Catalog#AMR‐001 Lot#AN‐05 http://scicrunch.org/resolver/AB_2039993 , 1:1,000.

Techniques:

The figure (a) shows the percentage of the calbindin‐D28k ( CB ) and calretinin ( CR ) immunoreactive populations that are also immunoreactive (ir) for the m1 acetylcholine receptor (m1 AC hR), collapsed across all cortical layers. 55% of CB ‐ir neurons express m1 AC hRs, while 10% of CR ‐ir neurons express m1 AC hRs. The figure (b) shows the same data (52% of CB ‐ir neurons and 11% of CR ‐ir neurons), but for layers II and III only. The figure (c) shows the percentage of cells immunoreactive for m1 AC hRs that express CB or CR collapsed across all cortical layers. 2% of m1‐ir neurons express CB , while 0.5% of m1‐ir cells express CR . The figure (d) shows the same data (4% of m1 AC hR‐ir neurons express CB , while 1% express CR ), but for layers II and III only. Bars indicate standard error, and asterisks indicate statistical significance ( p < 0.01)

Journal: Brain and Behavior

Article Title: Most calbindin‐immunoreactive neurons, but few calretinin‐immunoreactive neurons, express the m1 acetylcholine receptor in the middle temporal visual area of the macaque monkey

doi: 10.1002/brb3.1071

Figure Lengend Snippet: The figure (a) shows the percentage of the calbindin‐D28k ( CB ) and calretinin ( CR ) immunoreactive populations that are also immunoreactive (ir) for the m1 acetylcholine receptor (m1 AC hR), collapsed across all cortical layers. 55% of CB ‐ir neurons express m1 AC hRs, while 10% of CR ‐ir neurons express m1 AC hRs. The figure (b) shows the same data (52% of CB ‐ir neurons and 11% of CR ‐ir neurons), but for layers II and III only. The figure (c) shows the percentage of cells immunoreactive for m1 AC hRs that express CB or CR collapsed across all cortical layers. 2% of m1‐ir neurons express CB , while 0.5% of m1‐ir cells express CR . The figure (d) shows the same data (4% of m1 AC hR‐ir neurons express CB , while 1% express CR ), but for layers II and III only. Bars indicate standard error, and asterisks indicate statistical significance ( p < 0.01)

Article Snippet: Anti‐m1 muscarinic acetylcholine receptor , GST fusion protein corresponding to aa227‐353 of human m1 ACh receptor (GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGESVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK) , Alomone Labs (Jerusalem, Israel). Rabbit polyclonal. Catalog#AMR‐001 Lot#AN‐05 http://scicrunch.org/resolver/AB_2039993 , 1:1,000.

Techniques:

Neurons immunoreactive for the m1 acetylcholine receptor in layer III . Arrows mark cells that met counting criteria and were quantified. These neurons are characterized by strong somatic labeling appearing intense along the perimeter of the cell body. Scale bar = 20 µm

Journal: Brain and Behavior

Article Title: Most calbindin‐immunoreactive neurons, but few calretinin‐immunoreactive neurons, express the m1 acetylcholine receptor in the middle temporal visual area of the macaque monkey

doi: 10.1002/brb3.1071

Figure Lengend Snippet: Neurons immunoreactive for the m1 acetylcholine receptor in layer III . Arrows mark cells that met counting criteria and were quantified. These neurons are characterized by strong somatic labeling appearing intense along the perimeter of the cell body. Scale bar = 20 µm

Article Snippet: Anti‐m1 muscarinic acetylcholine receptor , GST fusion protein corresponding to aa227‐353 of human m1 ACh receptor (GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGESVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK) , Alomone Labs (Jerusalem, Israel). Rabbit polyclonal. Catalog#AMR‐001 Lot#AN‐05 http://scicrunch.org/resolver/AB_2039993 , 1:1,000.

Techniques: Labeling

Comparison of the m1 acetylcholine receptor (m1 AC hR) expression by populations immunoreactive for calretinin ( CR ), calbindin‐D28k ( CB ), and parvalbumin ( PV ) in primary visual area V1 (dark gray) and middle temporal area MT (light gray). In V1, 40% of CR ‐immunoreactive neurons, 60% of CB ‐immunoreactive neurons, and 80% of PV ‐immunoreactive neurons express m1 AC hR. Those numbers in MT are 10%, 55%, and 75%, respectively

Journal: Brain and Behavior

Article Title: Most calbindin‐immunoreactive neurons, but few calretinin‐immunoreactive neurons, express the m1 acetylcholine receptor in the middle temporal visual area of the macaque monkey

doi: 10.1002/brb3.1071

Figure Lengend Snippet: Comparison of the m1 acetylcholine receptor (m1 AC hR) expression by populations immunoreactive for calretinin ( CR ), calbindin‐D28k ( CB ), and parvalbumin ( PV ) in primary visual area V1 (dark gray) and middle temporal area MT (light gray). In V1, 40% of CR ‐immunoreactive neurons, 60% of CB ‐immunoreactive neurons, and 80% of PV ‐immunoreactive neurons express m1 AC hR. Those numbers in MT are 10%, 55%, and 75%, respectively

Article Snippet: Anti‐m1 muscarinic acetylcholine receptor , GST fusion protein corresponding to aa227‐353 of human m1 ACh receptor (GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGESVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRK) , Alomone Labs (Jerusalem, Israel). Rabbit polyclonal. Catalog#AMR‐001 Lot#AN‐05 http://scicrunch.org/resolver/AB_2039993 , 1:1,000.

Techniques: Expressing

FIGURE 1 Outline of the experimental design. Study 1 evaluated the impact of systemic xanomeline (XAN) on behavioural responses related to TS and comorbid disorders. Study 2 was designed to evaluate the involvement of M4 receptors in the effects of XAN, leveraging the selective M4 antagonist, VU06028418 and the M4 positive allosteric modulator (PAM), VU0467154. Study 3 was designed to evaluate the involvement of M1 receptors in the effects of XAN, using the selective M1 antagonist, VU0255035 and cevimeline (CEV), a muscarinic agonist with high affinity and potency on M1 and M3 but not M4 receptors. Study 4 evaluated the involvement of the dorsal striatum in the behavioural effects of XAN. Study 5 was used for the neurochemical investigations. The timelines for treatments and procedures are outlined in each panel. Abbreviations: PPI, prepulse inhibition of the acoustic startle. WB, western blotting. IF, immunofluorescence. For further details, see text.

Journal: British journal of pharmacology

Article Title: Activation of M 4 muscarinic receptors in the striatum reduces tic-like behaviours in two distinct murine models of Tourette syndrome.

doi: 10.1111/bph.16392

Figure Lengend Snippet: FIGURE 1 Outline of the experimental design. Study 1 evaluated the impact of systemic xanomeline (XAN) on behavioural responses related to TS and comorbid disorders. Study 2 was designed to evaluate the involvement of M4 receptors in the effects of XAN, leveraging the selective M4 antagonist, VU06028418 and the M4 positive allosteric modulator (PAM), VU0467154. Study 3 was designed to evaluate the involvement of M1 receptors in the effects of XAN, using the selective M1 antagonist, VU0255035 and cevimeline (CEV), a muscarinic agonist with high affinity and potency on M1 and M3 but not M4 receptors. Study 4 evaluated the involvement of the dorsal striatum in the behavioural effects of XAN. Study 5 was used for the neurochemical investigations. The timelines for treatments and procedures are outlined in each panel. Abbreviations: PPI, prepulse inhibition of the acoustic startle. WB, western blotting. IF, immunofluorescence. For further details, see text.

Article Snippet: Primary antibodies against M1 (Cat# NBP1–87466, RRID: AB_11021120, dilution 1:750; Novus Biological, Littleton, CO), M4 (Cat# NBP3-03052, RRID:AB_2943415, dilution 1:1000; Novus Biological) were incubated in TBS-T containing 3% (w/v) BSA buffer overnight at 4 C. Next, blots were washed in TBS-T and then incubated in TBS-T containing goat anti-rabbit HRP-conjugated (Cat# 31462, RRID: AB_228338, dilution 1:10000; ThermoFisher Scientific, Waltham, MA) secondary antibodies, for 90 min at room temperature.

Techniques: Inhibition, Western Blot, Immunofluorescence

FIGURE 5 The M1-selective antagonist VU0255035 (3–30 mgkg1, PO) does not reverse the ameliorative effects of xanomeline (XAN; 5 mgkg1, IP) in TS-related behaviours. Panels A-D show the combined effects of VU0255035 and XAN on (a) frequency of body and head jerks, (b) overall duration of grooming stereotypies, (c) acoustic startle amplitude and (d) acoustic prepulse inhibition (PPI) in CIN-d and control (Ctrl) mice. Panels (e)–(h) represent the effects of VU0255035 and XAN on the same behavioural paradigms in D1CT-7 and wild type (WT) male littermates. Data were analysed with two-way ANOVAs. X, P < 0.05 for main effect comparison of vehicle (VEH) with XAN; *, P < 0.05 for comparisons of vehicle-treated D1CT- 7 versus WT or CIN-d versus Ctrl mice; O, P < 0.05 for comparison of XAN and VU0244035 (30 mgkg1) versus VEH and VU0244035 (30 mgkg1). All data are shown as means ± SEM. n = 8 per group. For further details, see text.

Journal: British journal of pharmacology

Article Title: Activation of M 4 muscarinic receptors in the striatum reduces tic-like behaviours in two distinct murine models of Tourette syndrome.

doi: 10.1111/bph.16392

Figure Lengend Snippet: FIGURE 5 The M1-selective antagonist VU0255035 (3–30 mgkg1, PO) does not reverse the ameliorative effects of xanomeline (XAN; 5 mgkg1, IP) in TS-related behaviours. Panels A-D show the combined effects of VU0255035 and XAN on (a) frequency of body and head jerks, (b) overall duration of grooming stereotypies, (c) acoustic startle amplitude and (d) acoustic prepulse inhibition (PPI) in CIN-d and control (Ctrl) mice. Panels (e)–(h) represent the effects of VU0255035 and XAN on the same behavioural paradigms in D1CT-7 and wild type (WT) male littermates. Data were analysed with two-way ANOVAs. X, P < 0.05 for main effect comparison of vehicle (VEH) with XAN; *, P < 0.05 for comparisons of vehicle-treated D1CT- 7 versus WT or CIN-d versus Ctrl mice; O, P < 0.05 for comparison of XAN and VU0244035 (30 mgkg1) versus VEH and VU0244035 (30 mgkg1). All data are shown as means ± SEM. n = 8 per group. For further details, see text.

Article Snippet: Primary antibodies against M1 (Cat# NBP1–87466, RRID: AB_11021120, dilution 1:750; Novus Biological, Littleton, CO), M4 (Cat# NBP3-03052, RRID:AB_2943415, dilution 1:1000; Novus Biological) were incubated in TBS-T containing 3% (w/v) BSA buffer overnight at 4 C. Next, blots were washed in TBS-T and then incubated in TBS-T containing goat anti-rabbit HRP-conjugated (Cat# 31462, RRID: AB_228338, dilution 1:10000; ThermoFisher Scientific, Waltham, MA) secondary antibodies, for 90 min at room temperature.

Techniques: Inhibition, Control, Comparison

FIGURE 9 CIN-d mice show a significant reduction in M4, but not M1, receptor levels in the dorsal striatum. Representative immunoblot (a) and quantification of M1 (b) and M4 (c) expression levels in dorsal striatum expressed as a percentage of the control group (Ctrl). Values are expressed as mean ± SEM, n = 6.

Journal: British journal of pharmacology

Article Title: Activation of M 4 muscarinic receptors in the striatum reduces tic-like behaviours in two distinct murine models of Tourette syndrome.

doi: 10.1111/bph.16392

Figure Lengend Snippet: FIGURE 9 CIN-d mice show a significant reduction in M4, but not M1, receptor levels in the dorsal striatum. Representative immunoblot (a) and quantification of M1 (b) and M4 (c) expression levels in dorsal striatum expressed as a percentage of the control group (Ctrl). Values are expressed as mean ± SEM, n = 6.

Article Snippet: Primary antibodies against M1 (Cat# NBP1–87466, RRID: AB_11021120, dilution 1:750; Novus Biological, Littleton, CO), M4 (Cat# NBP3-03052, RRID:AB_2943415, dilution 1:1000; Novus Biological) were incubated in TBS-T containing 3% (w/v) BSA buffer overnight at 4 C. Next, blots were washed in TBS-T and then incubated in TBS-T containing goat anti-rabbit HRP-conjugated (Cat# 31462, RRID: AB_228338, dilution 1:10000; ThermoFisher Scientific, Waltham, MA) secondary antibodies, for 90 min at room temperature.

Techniques: Western Blot, Expressing, Control

Journal: Cell Reports Medicine

Article Title: Cholinergic signaling via muscarinic M1 receptor confers resistance to docetaxel in prostate cancer

doi: 10.1016/j.xcrm.2023.101388

Figure Lengend Snippet:

Article Snippet: Human CHRM1 siRNA , Origene , Cat# SR300807.

Techniques: Western Blot, Double Staining Immunohistochemistry, Staining, Virus, shRNA, Control, Subcloning, Recombinant, Reverse Transcription, Transfection, Bicinchoninic Acid Protein Assay, Cell Viability Assay, In Situ, Calcium Flux Assay, Enzyme-linked Immunosorbent Assay, Gel Extraction, Mutagenesis, Purification, Ligation, Software

TaqMan gene expression assays used for real-time PCR expression analysis

Journal: BMC Urology

Article Title: Expression of components of the urothelial cholinergic system in bladder and cultivated primary urothelial cells of the pig

doi: 10.1186/s12894-019-0495-z

Figure Lengend Snippet: TaqMan gene expression assays used for real-time PCR expression analysis

Article Snippet: CHRM1-Pig , Taqman Gene ex assay MTO, sm, Ss03393581_u1.

Techniques: Gene Expression, Real-time Polymerase Chain Reaction, Expressing, Sequencing